PRPF6 Recombinant Protein Antigen

Images

 
There are currently no images for PRPF6 Protein (NBP1-92298PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PRPF6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRPF6.

Source: E.coli

Amino Acid Sequence: ARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRPF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-92298.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PRPF6 Recombinant Protein Antigen

  • androgen receptor N-terminal domain transactivating protein-1
  • ANT-1
  • bB152O15.1
  • C20orf14
  • chromosome 20 open reading frame 14
  • hPrp6
  • p102 U5 small nuclear ribonucleoprotein particle-binding protein
  • pre-mRNA-processing factor 6
  • PRP6 homolog
  • PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)
  • PRP6 pre-mRNA processing factor 6 homolog (yeast)
  • Prp6
  • putative mitochondrial outer membrane protein import receptor
  • TOM
  • U5 snRNP-associated 102 kDa protein
  • U5-102 kDa protein
  • U5-102K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-80671
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NB100-695
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
NB100-40853
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87863
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-65485
Species: Hu
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-92298PEP
Species: Hu
Applications: AC

Publications for PRPF6 Protein (NBP1-92298PEP) (0)

There are no publications for PRPF6 Protein (NBP1-92298PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPF6 Protein (NBP1-92298PEP) (0)

There are no reviews for PRPF6 Protein (NBP1-92298PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PRPF6 Protein (NBP1-92298PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PRPF6 Protein (NBP1-92298PEP)

Discover related pathways, diseases and genes to PRPF6 Protein (NBP1-92298PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPF6 Protein (NBP1-92298PEP)

Discover more about diseases related to PRPF6 Protein (NBP1-92298PEP).
 

Pathways for PRPF6 Protein (NBP1-92298PEP)

View related products by pathway.

PTMs for PRPF6 Protein (NBP1-92298PEP)

Learn more about PTMs related to PRPF6 Protein (NBP1-92298PEP).

Blogs on PRPF6

There are no specific blogs for PRPF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRPF6 Antibody
NBP1-92298
TOMM20 Antibody
NBP1-81556

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRPF6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPF6