Recombinant Human PRPF4B Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PRPF4B Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 898-1005 of Human PRPF4B

Source: Wheat Germ

Amino Acid Sequence: LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRPF4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRPF4B Protein

  • dJ1013A10.1 (PRP4 protein kinase homolog)
  • dJ1013A10.1
  • KIAA0536EC 2.7.11.1
  • PR4H
  • protein-serine/threonine kinase
  • PRP4 kinase
  • PRP4 pre-mRNA processing factor 4 homolog B (yeast)
  • PRP4 pre-mRNA-processing factor 4 homolog
  • PRP4H
  • PRP4K
  • PRP4Prp4
  • serine/threonine-protein kinase PRP4 homolog

Background

Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-86191
Species: Hu
Applications: ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-90821
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71833
Species: Hu, Mu
Applications: WB
H00008899-Q02
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PRPF4B Partial Recombinant Protein (H00008899-Q02) (0)

There are no publications for PRPF4B Partial Recombinant Protein (H00008899-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPF4B Partial Recombinant Protein (H00008899-Q02) (0)

There are no reviews for PRPF4B Partial Recombinant Protein (H00008899-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRPF4B Partial Recombinant Protein (H00008899-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PRPF4B Partial Recombinant Protein (H00008899-Q02)

Discover related pathways, diseases and genes to PRPF4B Partial Recombinant Protein (H00008899-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPF4B Partial Recombinant Protein (H00008899-Q02)

Discover more about diseases related to PRPF4B Partial Recombinant Protein (H00008899-Q02).
 

Pathways for PRPF4B Partial Recombinant Protein (H00008899-Q02)

View related products by pathway.

PTMs for PRPF4B Partial Recombinant Protein (H00008899-Q02)

Learn more about PTMs related to PRPF4B Partial Recombinant Protein (H00008899-Q02).
 

Research Areas for PRPF4B Partial Recombinant Protein (H00008899-Q02)

Find related products by research area.

Blogs on PRPF4B

There are no specific blogs for PRPF4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRPF4B Antibody
NBP1-82999

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRPF4B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPF4B