Protogenin Antibody

Product Discontinued

Protogenin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HYIIDDLEPASNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPIPAKYRRGQVVLYRLSFR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRTG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Protogenin Antibody

• FLJ12795
• FLJ13221
• FLJ25756
• IGDCC5
• immunoglobulin superfamily, DCC subclass, member 5
• Protein Shen-Dan
• protogenin homolog (Gallus gallus)
• Protogenin
• PRTG
• RPTG
• Shen-Dan

Background

PRTG may play a role in anteroposterior axis elongation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRTG