Protogenin Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: HYIIDDLEPASNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPIPAKYRRGQVVLYRLSFR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PRTG |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Protogenin Antibody
Background
PRTG may play a role in anteroposterior axis elongation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Block, IHC, WB
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Publications for Protogenin Antibody (NBP1-82051) (0)
There are no publications for Protogenin Antibody (NBP1-82051).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Protogenin Antibody (NBP1-82051) (0)
There are no reviews for Protogenin Antibody (NBP1-82051).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Protogenin Antibody (NBP1-82051) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Protogenin Products
Blogs on Protogenin