Protocadherin alpha-9 Antibody (3C1)

Images

 
There are currently no images for Protocadherin alpha-9 Antibody (H00009752-M04).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C1
Clonality
Monoclonal
Host
Mouse

Order Details

Protocadherin alpha-9 Antibody (3C1) Summary

Immunogen
PCDHA9 (NP_114063, 284 a.a. ~ 382 a.a) partial recombinant protein with GST tag.DVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDK GFPPLAGHCTLLVEVVDVNDNAPQLTIKTLSVPVKEDAQLGT VIALISVIDLDADA
Localization
Cell membrane; Single-pass type I membrane protein
Specificity
PCDHA9 - protocadherin alpha 9
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCDHA9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protocadherin alpha-9 Antibody (3C1)

  • KIAA0345-like 5
  • KIAA0345PCDH-ALPHA9
  • PCDH-alpha-9
  • protocadherin alpha 9
  • protocadherin alpha-9

Background

This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6570
Species: Hu
Applications: WB, IHC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NB110-58867
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-31308
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30030
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF4185
Species: Hu
Applications: ICC
H00001021-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-80960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Flow, IHC, ICC
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC, ICFlow
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
NBP2-33711
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71662
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6028
Species: Hu
Applications: WB, IHC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Protocadherin alpha-9 Antibody (H00009752-M04) (0)

There are no publications for Protocadherin alpha-9 Antibody (H00009752-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin alpha-9 Antibody (H00009752-M04) (0)

There are no reviews for Protocadherin alpha-9 Antibody (H00009752-M04). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin alpha-9 Antibody (H00009752-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin alpha-9 Antibody (3C1) Products

Related Products by Gene

Bioinformatics Tool for Protocadherin alpha-9 Antibody (H00009752-M04)

Discover related pathways, diseases and genes to Protocadherin alpha-9 Antibody (H00009752-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin alpha-9 Antibody (H00009752-M04)

Discover more about diseases related to Protocadherin alpha-9 Antibody (H00009752-M04).
 

Pathways for Protocadherin alpha-9 Antibody (H00009752-M04)

View related products by pathway.

Blogs on Protocadherin alpha-9

There are no specific blogs for Protocadherin alpha-9, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PCDHA9
Entrez
OMIM
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00009752-M04 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought