Protocadherin-8 Antibody

Images

 
Immunohistochemistry: Protocadherin-8 Antibody [NBP1-88850] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protocadherin-8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGHSDRCWSPSCSGPNAHPSPHPPAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEKVLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRYLSPKKGANEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDH8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Protocadherin-8 Protein (NBP1-88850PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protocadherin-8 Antibody

  • Arcadlin
  • PAPC
  • PCDH8
  • protocadherin 8
  • Protocadherin8
  • Protocadherin-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
AF7669
Species: Hu, Mu, Rt
Applications: WB
AF198
Species: Mu
Applications: WB, IHC
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46340
Species: Hu
Applications: WB, IHC, IF
NBL1-14149
Species: Hu
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
35740002
Species: Hu
Applications: WB, ELISA

Publications for Protocadherin-8 Antibody (NBP1-88850) (0)

There are no publications for Protocadherin-8 Antibody (NBP1-88850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-8 Antibody (NBP1-88850) (0)

There are no reviews for Protocadherin-8 Antibody (NBP1-88850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Protocadherin-8 Antibody (NBP1-88850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin-8 Products

Bioinformatics Tool for Protocadherin-8 Antibody (NBP1-88850)

Discover related pathways, diseases and genes to Protocadherin-8 Antibody (NBP1-88850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-8 Antibody (NBP1-88850)

Discover more about diseases related to Protocadherin-8 Antibody (NBP1-88850).
 

Pathways for Protocadherin-8 Antibody (NBP1-88850)

View related products by pathway.

PTMs for Protocadherin-8 Antibody (NBP1-88850)

Learn more about PTMs related to Protocadherin-8 Antibody (NBP1-88850).

Blogs on Protocadherin-8

There are no specific blogs for Protocadherin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH8
Entrez