Protein phosphatase 1F Antibody

Images

 
Western Blot: Protein phosphatase 1F Antibody [NBP1-88206] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunocytochemistry/ Immunofluorescence: Protein phosphatase 1F Antibody [NBP1-88206] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: Protein phosphatase 1F Antibody [NBP1-88206] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protein phosphatase 1F Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPM1F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Protein phosphatase 1F Protein (NBP1-88206PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protein phosphatase 1F Antibody

  • Ca(2+)/calmodulin-dependent protein kinase phosphatase
  • CaMKPaseCaM-kinase phosphatase
  • EC 3.1.3.16
  • FEM-2
  • hFEM-2
  • KIAA0015POPX2CAMKP
  • Partner of PIX 2
  • PP2C phosphatase
  • Protein fem-2 homolog
  • protein phosphatase 1F (PP2C domain containing)
  • protein phosphatase 1F
  • protein phosphatase, Mg2+/Mn2+ dependent, 1F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86649
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37428
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF7899
Species: Hu
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-32751
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2110
Species: Hu
Applications: WB, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Protein phosphatase 1F Antibody (NBP1-88206) (0)

There are no publications for Protein phosphatase 1F Antibody (NBP1-88206).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein phosphatase 1F Antibody (NBP1-88206) (0)

There are no reviews for Protein phosphatase 1F Antibody (NBP1-88206). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protein phosphatase 1F Antibody (NBP1-88206) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein phosphatase 1F Products

Bioinformatics Tool for Protein phosphatase 1F Antibody (NBP1-88206)

Discover related pathways, diseases and genes to Protein phosphatase 1F Antibody (NBP1-88206). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein phosphatase 1F Antibody (NBP1-88206)

Discover more about diseases related to Protein phosphatase 1F Antibody (NBP1-88206).
 

Pathways for Protein phosphatase 1F Antibody (NBP1-88206)

View related products by pathway.

PTMs for Protein phosphatase 1F Antibody (NBP1-88206)

Learn more about PTMs related to Protein phosphatase 1F Antibody (NBP1-88206).
 

Research Areas for Protein phosphatase 1F Antibody (NBP1-88206)

Find related products by research area.

Blogs on Protein phosphatase 1F

There are no specific blogs for Protein phosphatase 1F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein phosphatase 1F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1F