Protein kinase-like protein SgK493 Recombinant Protein Antigen

Images

 
There are currently no images for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Protein kinase-like protein SgK493 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKDCC.

Source: E.coli

Amino Acid Sequence: TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PKDCC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-80758.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Protein kinase-like protein SgK493 Recombinant Protein Antigen

  • EC 2.7
  • FLJ18197
  • MGC125960
  • protein kinase domain containing, cytoplasmic homolog (mouse)
  • protein kinase domain-containing protein, cytoplasmic
  • Protein kinase-like protein SgK493
  • SgK493
  • Sugen kinase 493
  • Vertebrate lonesome kinase
  • Vlk

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
H00256076-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-62583
Species: Hu
Applications: WB
DNST0
Species: Hu
Applications: ELISA
NB100-56077
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13306
Species: Hu
Applications: IHC, IHC-P, WB
AF2209
Species: Hu
Applications: ELISA, IHC, WB
AF-242-PB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-57299
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
1596-B1
Species: Rt
Applications: Bind
NBP2-24464
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-61421
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-91816
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80758PEP
Species: Hu
Applications: AC

Publications for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP) (0)

There are no publications for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP) (0)

There are no reviews for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protein kinase-like protein SgK493 Products

Bioinformatics Tool for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP)

Discover related pathways, diseases and genes to Protein kinase-like protein SgK493 Protein (NBP1-80758PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP)

Discover more about diseases related to Protein kinase-like protein SgK493 Protein (NBP1-80758PEP).
 

Pathways for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP)

View related products by pathway.

Research Areas for Protein kinase-like protein SgK493 Protein (NBP1-80758PEP)

Find related products by research area.

Blogs on Protein kinase-like protein SgK493

There are no specific blogs for Protein kinase-like protein SgK493, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Protein kinase-like protein SgK493 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PKDCC