Proteasome subunit beta type 4 Recombinant Protein Antigen

Images

 
There are currently no images for Proteasome subunit beta type 4 Protein (NBP1-89681PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Proteasome subunit beta type 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB4.

Source: E. coli

Amino Acid Sequence: VIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89681.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Proteasome subunit beta type 4 Recombinant Protein Antigen

  • EC 3.4.25.1
  • HN3
  • HsBPROS26
  • HsN3
  • Macropain beta chain
  • Multicatalytic endopeptidase complex beta chain
  • PROS26
  • PROS-26
  • PROS26PROS-26
  • proteasome (prosome, macropain) subunit, beta type, 4
  • Proteasome beta chain
  • Proteasome chain 3
  • Proteasome subunit beta type 4
  • proteasome subunit beta type-4
  • proteasome subunit HsN3
  • proteasome subunit, beta type, 4,26 kDa prosomal protein
  • PSMB4

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35329
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP3-35253
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-93792
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF2699
Species: Mu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-32510
Species: Hu
Applications: ELISA, IHC, IHC-P, KO, WB
NBP1-03349
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-89428
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-13820
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
AF965
Species: Mu
Applications: IHC, Neut, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-89681PEP
Species: Hu
Applications: AC

Publications for Proteasome subunit beta type 4 Protein (NBP1-89681PEP) (0)

There are no publications for Proteasome subunit beta type 4 Protein (NBP1-89681PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome subunit beta type 4 Protein (NBP1-89681PEP) (0)

There are no reviews for Proteasome subunit beta type 4 Protein (NBP1-89681PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proteasome subunit beta type 4 Protein (NBP1-89681PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteasome subunit beta type 4 Products

Research Areas for Proteasome subunit beta type 4 Protein (NBP1-89681PEP)

Find related products by research area.

Blogs on Proteasome subunit beta type 4

There are no specific blogs for Proteasome subunit beta type 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proteasome subunit beta type 4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB4