Proteasome 26S S5 Antibody (3E2.)

Images

 
Western Blot: Proteasome 26S S5 Antibody (3E2) [H00005711-M01] - PSMD5 monoclonal antibody (M01), clone 3E2 Analysis of PSMD5 expression in A-431.
Immunohistochemistry-Paraffin: Proteasome 26S S5 Antibody (3E2) [H00005711-M01] - Analysis of monoclonal antibody to PSMD5 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Sandwich ELISA: Proteasome 26S S5 Antibody (3E2) [H00005711-M01] - Detection limit for recombinant GST tagged PSMD5 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Proteasome 26S S5 Antibody (3E2.) Summary

Immunogen
PSMD5 (AAH14478 405 a.a. - 504 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE
Specificity
PSMD5 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMD5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Proteasome 26S S5 Antibody (3E2.)

  • KIAA007226S proteasome non-ATPase regulatory subunit 5
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 5,26S proteasome subunit S5B
  • S5BMGC23145,26S protease subunit S5 basic

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator base.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12553
Species: Hu
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82310
Species: Hu
Applications: WB, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
AF5540
Species: Mu
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: WB, IHC
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Proteasome 26S S5 Antibody (H00005711-M01) (0)

There are no publications for Proteasome 26S S5 Antibody (H00005711-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 26S S5 Antibody (H00005711-M01) (0)

There are no reviews for Proteasome 26S S5 Antibody (H00005711-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 26S S5 Antibody (H00005711-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 26S S5 Products

Bioinformatics Tool for Proteasome 26S S5 Antibody (H00005711-M01)

Discover related pathways, diseases and genes to Proteasome 26S S5 Antibody (H00005711-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 26S S5 Antibody (H00005711-M01)

Discover more about diseases related to Proteasome 26S S5 Antibody (H00005711-M01).
 

Pathways for Proteasome 26S S5 Antibody (H00005711-M01)

View related products by pathway.

Research Areas for Proteasome 26S S5 Antibody (H00005711-M01)

Find related products by research area.

Blogs on Proteasome 26S S5

There are no specific blogs for Proteasome 26S S5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 26S S5 Antibody (3E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD5
Entrez
OMIM
Uniprot