Proteasome 20S beta 3 Antibody

Western Blot: Proteasome 20S beta 3 Antibody [H00005691-B01P] - Analysis of PSMB3 expression in human liver.

Immunocytochemistry/Immunofluorescence: Proteasome 20S beta 3 Antibody [H00005691-B01P] - Analysis of purified antibody to PSMB3 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: Proteasome 20S beta 3 Antibody [H00005691-B01P] - Analysis of PSMB3 expression in transfected 293T cell line by PSMB3 polyclonal antibody. Lane 1: PSMB3 transfected lysate(22.55 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Proteasome 20S beta 3 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PSMB3 (NP_002786.2, 1 a.a. - 205 a.a.) full-length human protein. MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
• Specificity: PSMB3 - proteasome (prosome, macropain) subunit, beta type, 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PSMB3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Proteasome 20S beta 3 Antibody

• EC 3.4.25.1
• HC10-II
• MGC4147
• proteasome (prosome, macropain) subunit, beta type, 3
• Proteasome 20S beta 3
• Proteasome chain 13
• Proteasome component C10-II
• proteasome subunit beta type-3
• Proteasome theta chain
• PSMB3

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMB3
• Entrez:
  • 5691(Human)
• Uniprot:
  • NP_002786.2(Human)