Recombinant Human Protease Inhibitor 15 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Protease Inhibitor 15 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 18-117 of Human PI15 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PI15

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Protease Inhibitor 15 Protein

  • 25 kDa trypsin inhibitor
  • CRISP8
  • CRISP-8
  • Cysteine-rich secretory protein 8
  • P24TI
  • p25TI
  • P25TIDKFZp686F0366
  • peptidase inhibitor 15
  • PI-15
  • protease inhibitor 15
  • sugarCrisp

Background

PI15 - protease inhibitor 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4929
Species: Mu
Applications: WB
MAB2545
Species: Hu
Applications: WB, IHC, IP
NBP1-84413
Species: Hu
Applications: IHC, IHC-P
NBP2-47126
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4468
Species: Mu
Applications: WB
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP1-85143
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00051050-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01) (0)

There are no publications for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01) (0)

There are no reviews for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protease Inhibitor 15 Products

Bioinformatics Tool for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01)

Discover related pathways, diseases and genes to Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01)

Discover more about diseases related to Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01).
 

Pathways for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01)

View related products by pathway.

Research Areas for Protease Inhibitor 15 Partial Recombinant Protein (H00051050-Q01)

Find related products by research area.

Blogs on Protease Inhibitor 15

There are no specific blogs for Protease Inhibitor 15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Protease Inhibitor 15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PI15