Prostaglandin I2 Synthase Antibody - BSA Free

Western Blot: PTGIS Antibody [NBP1-62390] - Human Brain lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Prostaglandin I2 Synthase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGIS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Prostaglandin I2 Synthase Antibody - BSA Free

• CYP8
• CYP8A1
• CYP8A1PTGI
• CYP8prostacyclin synthase
• EC 5.3.99.4
• MGC126858
• MGC126860
• PGIS
• PGIScytochrome P450, family 8, subfamily A, polypeptide 1
• Prostacyclin Synthase
• prostaglandin I2 (prostacyclin) synthase
• Prostaglandin I2 synthase
• PTGI
• PTGIS

Background

PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prostaglandin I2 Synthase Antibody (NBP1-62390)(1)

Publication using NBP1-62390

• Luo L, Chua YB, Liu T et al. Muscle Injuries Induce a Prostacyclin-PPAR?/PGC1a-FAO Spike That Boosts Regeneration Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2023-05-04 [PMID: 37140179] (WB, Mouse)

Bioinformatics

• Gene Symbol: PTGIS
• Uniprot:
  • Q16647(Human)