Prostaglandin E Synthase Antibody (2B9)

Images

 
Immunoprecipitation: Prostaglandin E Synthase Antibody (2B9) [H00009536-M04] - Analysis of PTGES transfected lysate using anti-PTGES monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTGES rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
2B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Prostaglandin E Synthase Antibody (2B9) Summary

Immunogen
PTGES (AAH08280.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Specificity
PTGES - prostaglandin E synthase (2B9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTGES
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Prostaglandin E Synthase Antibody (2B9)

  • EC 5.3.99.3
  • MGC10317
  • MGST1L1MGST1-like 1
  • MGST1-L1mPGES-1
  • MGST-IV
  • Microsomal glutathione S-transferase 1-like 1
  • Microsomal prostaglandin E synthase 1
  • MPGES
  • MPGES1
  • MPGES-1
  • p53-induced apoptosis protein 12
  • p53-induced gene 12 protein
  • PGESmicrosomal prostaglandin E synthase-1
  • PIG12glutathione S-transferase 1-like 1
  • PP102
  • PP1294
  • prostaglandin E synthase
  • TP53I12
  • tumor protein p53 inducible protein 12

Background

The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, Gp, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-73623
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NLS3898
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-02321
Species: Hu, Mu, Rt, Po, Bt, Bv
Applications: ELISA, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00009536-M04
Species: Hu
Applications: ELISA, IP

Publications for Prostaglandin E Synthase Antibody (H00009536-M04) (0)

There are no publications for Prostaglandin E Synthase Antibody (H00009536-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostaglandin E Synthase Antibody (H00009536-M04) (0)

There are no reviews for Prostaglandin E Synthase Antibody (H00009536-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Prostaglandin E Synthase Antibody (H00009536-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Prostaglandin E Synthase Products

Bioinformatics Tool for Prostaglandin E Synthase Antibody (H00009536-M04)

Discover related pathways, diseases and genes to Prostaglandin E Synthase Antibody (H00009536-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostaglandin E Synthase Antibody (H00009536-M04)

Discover more about diseases related to Prostaglandin E Synthase Antibody (H00009536-M04).
 

Pathways for Prostaglandin E Synthase Antibody (H00009536-M04)

View related products by pathway.

PTMs for Prostaglandin E Synthase Antibody (H00009536-M04)

Learn more about PTMs related to Prostaglandin E Synthase Antibody (H00009536-M04).

Blogs on Prostaglandin E Synthase

There are no specific blogs for Prostaglandin E Synthase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prostaglandin E Synthase Antibody (2B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGES
Entrez
Uniprot