Prolyl endopeptidase-like Antibody

Images

 
Immunohistochemistry-Paraffin: Prolyl endopeptidase-like Antibody [NBP2-31868] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prolyl endopeptidase-like Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PREPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Prolyl endopeptidase-like Protein (NBP2-31868PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prolyl endopeptidase-like Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.83
  • KIAA0436FLJ16627
  • prolyl endopeptidase-like
  • Prolylendopeptidase-like
  • putative prolyl oligopeptidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
H00005495-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, PLA, RNAi
NBP2-01859
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81728
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for Prolyl endopeptidase-like Antibody (NBP2-31868) (0)

There are no publications for Prolyl endopeptidase-like Antibody (NBP2-31868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prolyl endopeptidase-like Antibody (NBP2-31868) (0)

There are no reviews for Prolyl endopeptidase-like Antibody (NBP2-31868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Prolyl endopeptidase-like Antibody (NBP2-31868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prolyl endopeptidase-like Products

Bioinformatics Tool for Prolyl endopeptidase-like Antibody (NBP2-31868)

Discover related pathways, diseases and genes to Prolyl endopeptidase-like Antibody (NBP2-31868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prolyl endopeptidase-like Antibody (NBP2-31868)

Discover more about diseases related to Prolyl endopeptidase-like Antibody (NBP2-31868).
 

Pathways for Prolyl endopeptidase-like Antibody (NBP2-31868)

View related products by pathway.

PTMs for Prolyl endopeptidase-like Antibody (NBP2-31868)

Learn more about PTMs related to Prolyl endopeptidase-like Antibody (NBP2-31868).

Blogs on Prolyl endopeptidase-like

There are no specific blogs for Prolyl endopeptidase-like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prolyl endopeptidase-like Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PREPL
Uniprot