PP2C beta/PPM1B Antibody (1A3-2A4)

Images

 
Western Blot: PP2C beta/PPM1B Antibody (1A3-2A4) [H00005495-M01] - Analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody (M01), clone 1A3-2A4.Lane 1: PPM1B transfected lysate(52.643 ...read more
Immunocytochemistry/ Immunofluorescence: PP2C beta/PPM1B Antibody (1A3-2A4) [H00005495-M01] - Analysis of monoclonal antibody to PPM1B on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PP2C beta/PPM1B Antibody (1A3-2A4) [H00005495-M01] - Analysis of PPM1B over-expressed 293 cell line, cotransfected with PPM1B Validated Chimera RNAi ( Cat # H00005495-R01V ) (Lane 2) or non-transfected ...read more
Proximity Ligation Assay: PP2C beta/PPM1B Antibody (1A3-2A4) [H00005495-M01] - Analysis of protein-protein interactions between ARRB2 and PPM1B. HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 ...read more
Immunoprecipitation: PP2C beta/PPM1B Antibody (1A3-2A4) [H00005495-M01] - Analysis of PPM1B transfected lysate using anti-PPM1B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPM1B monoclonal ...read more
ELISA: PP2C beta/PPM1B Antibody (1A3-2A4) [H00005495-M01] - Detection limit for recombinant GST tagged PPM1B is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, PLA, RNAi
Clone
1A3-2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PP2C beta/PPM1B Antibody (1A3-2A4) Summary

Immunogen
PPM1B (AAH12002, 1 a.a. - 192 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Specificity
PPM1B - protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPM1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Proximity Ligation Assay
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein and transfected lysate for WB. It has also been used for IF, RNAi Validation and ELISA.
Positive Control
PP2C beta/PPM1B Lysate (NBP2-65659)
Publications
Read Publication using
H00005495-M01 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PP2C beta/PPM1B Antibody (1A3-2A4)

  • EC 3.1.3.16
  • MGC21657
  • PP2C beta
  • Pp2c2
  • PP2CB
  • PP2C-beta
  • PP2C-beta-X
  • PP2CBmagnesium-dependent, beta isoform
  • PPM1B
  • protein phosphatase 1B
  • Protein phosphatase 2C isoform beta
  • protein phosphatase 2C-like protein
  • protein phosphatase, Mg2+/Mn2+ dependent, 1B

Background

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32751
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31868
Species: Hu
Applications: IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-01859
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-67850
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP

Publications for PP2C beta/PPM1B Antibody (H00005495-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PP2C beta/PPM1B Antibody (H00005495-M01) (0)

There are no reviews for PP2C beta/PPM1B Antibody (H00005495-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PP2C beta/PPM1B Antibody (H00005495-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PP2C beta/PPM1B Antibody (H00005495-M01)

Discover related pathways, diseases and genes to PP2C beta/PPM1B Antibody (H00005495-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C beta/PPM1B Antibody (H00005495-M01)

Discover more about diseases related to PP2C beta/PPM1B Antibody (H00005495-M01).
 

Pathways for PP2C beta/PPM1B Antibody (H00005495-M01)

View related products by pathway.

PTMs for PP2C beta/PPM1B Antibody (H00005495-M01)

Learn more about PTMs related to PP2C beta/PPM1B Antibody (H00005495-M01).
 

Research Areas for PP2C beta/PPM1B Antibody (H00005495-M01)

Find related products by research area.

Blogs on PP2C beta/PPM1B

There are no specific blogs for PP2C beta/PPM1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PP2C beta/PPM1B Antibody (1A3-2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1B
Entrez
OMIM
Uniprot