Proenkephalin Antibody (9E7)

Images

 
Western Blot: Proenkephalin Antibody (9E7) [H00005179-M04] - Analysis of PENK expression in transfected 293T cell line by PENK monoclonal antibody (M04), clone 9E7. Lane 1: PENK transfected lysate (Predicted MW: 29.48 ...read more
Sandwich ELISA: Proenkephalin Antibody (9E7) [H00005179-M04] - Detection limit for recombinant GST tagged PENK is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
9E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Proenkephalin Antibody (9E7) Summary

Immunogen
PENK (AAH32505, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa. MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADISFLACVMECEGKLPSLKIWETCKELLQLSRPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PENK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
It has been used for ELISA and WB.
Reviewed Applications
Read 1 Review rated 5
using
H00005179-M04 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Proenkephalin Antibody (9E7)

  • enkephalin A
  • preproenkephalin
  • proenkephalin
  • proenkephalin-A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00005173-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-48272
Species: Hu, Pm, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15699
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P

Publications for Proenkephalin Antibody (H00005179-M04) (0)

There are no publications for Proenkephalin Antibody (H00005179-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Proenkephalin Antibody (H00005179-M04) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00005179-M04:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Proenkephalin H00005179-M04
Enlarge
5
reviewed by:
Sarah Miller
Western Blot Human 11/08/2021
View

Summary

ApplicationWestern Blot
Sample TestedDorsal root ganglia neurons
SpeciesHuman
Lot9E7

Comments

CommentsPrimary antibody dilution 1:1000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proenkephalin Antibody (H00005179-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proenkephalin Products

Bioinformatics Tool for Proenkephalin Antibody (H00005179-M04)

Discover related pathways, diseases and genes to Proenkephalin Antibody (H00005179-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proenkephalin Antibody (H00005179-M04)

Discover more about diseases related to Proenkephalin Antibody (H00005179-M04).
 

Pathways for Proenkephalin Antibody (H00005179-M04)

View related products by pathway.

PTMs for Proenkephalin Antibody (H00005179-M04)

Learn more about PTMs related to Proenkephalin Antibody (H00005179-M04).
 

Research Areas for Proenkephalin Antibody (H00005179-M04)

Find related products by research area.

Blogs on Proenkephalin

There are no specific blogs for Proenkephalin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Sarah Miller
11/08/2021
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol PENK
Uniprot