Proapoptotic Caspase Adaptor Protein Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MZB1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:1000-1:2500
- Western Blot 0.04 - 0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control |
|
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Proapoptotic Caspase Adaptor Protein Antibody
Background
Proapoptotic Caspase Adaptor Protein may be involved in regulation of apoptosis
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Publications for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287) (0)
There are no publications for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287) (0)
There are no reviews for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Additional Proapoptotic Caspase Adaptor Protein Products
Bioinformatics Tool for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)
Discover related pathways, diseases and genes to Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)
Discover more about diseases related to Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287).
| | Pathways for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)
View related products by pathway.
|
PTMs for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)
Learn more about PTMs related to Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287).
| | Research Areas for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)
Find related products by research area.
|
Blogs on Proapoptotic Caspase Adaptor Protein