Proapoptotic Caspase Adaptor Protein Antibody

Images

 
Independent Antibodies: Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Analysis using Anti-MZB1 antibody NBP1-92287 (A) shows similar pattern to independent antibody NBP2-55874 (B).
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver shows no positivity in hepatocytes as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver, lymph node, placenta and small intestine using Anti-MZB1 antibody ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Analysis in human lymph node and liver tissues using NBP1-92287 antibody. Corresponding MZB1 ...read more
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proapoptotic Caspase Adaptor Protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MZB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Jurkat Staurosporine Treated / Untreated Cell Lysate
Control Peptide
Proapoptotic Caspase Adaptor Protein Protein (NBP1-92287PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proapoptotic Caspase Adaptor Protein Antibody

  • caspase-2 binding protein
  • FLJ32987
  • HSPC190
  • marginal zone B and B1 cell-specific protein
  • MGC29506
  • PACAP
  • pERp1
  • plasma cell-induced ER protein 1
  • plasma cell-induced resident endoplasmic reticulum protein
  • Plasma cell-induced resident ER protein
  • Proapoptotic caspase adapter protein
  • proapoptotic caspase adaptor protein

Background

Proapoptotic Caspase Adaptor Protein may be involved in regulation of apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6380
Species: Mu
Applications: WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP2-47340
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB5416
Species: Hu
Applications: IHC
NBP2-92318
Species: Hu, Mu, Rt
Applications: WB
NBP2-48988
Species: Hu
Applications: IHC, IHC-P
NBP3-04850
Species: Hu, Mu, Rt
Applications: WB
NBP1-36951
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
AF3499
Species: Hu
Applications: WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB

Publications for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287) (0)

There are no publications for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287) (0)

There are no reviews for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Proapoptotic Caspase Adaptor Protein Products

Bioinformatics Tool for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)

Discover related pathways, diseases and genes to Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)

Discover more about diseases related to Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287).
 

Pathways for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)

View related products by pathway.

PTMs for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)

Learn more about PTMs related to Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287).
 

Research Areas for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)

Find related products by research area.

Blogs on Proapoptotic Caspase Adaptor Protein

There are no specific blogs for Proapoptotic Caspase Adaptor Protein, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proapoptotic Caspase Adaptor Protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MZB1