PRKCSH Antibody - BSA Free

Immunohistochemistry-Paraffin: PRKCSH Antibody [NBP2-38511] - Staining of human thyroid gland shows high expression.

Immunohistochemistry: PRKCSH Antibody [NBP2-38511] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: PRKCSH Antibody [NBP2-38511] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: PRKCSH Antibody [NBP2-38511] - Staining in human thyroid gland and skeletal muscle tissues using anti-PRKCSH antibody. Corresponding PRKCSH RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRKCSH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRKCSH Antibody - BSA Free (NBP2-38511) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTC
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKCSH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PRKCSH Protein (NBP2-38511PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PRKCSH Antibody - BSA Free

• AGE-R2,80K-H protein
• G19P1AGE-binding receptor 2
• glucosidase 2 subunit beta
• Glucosidase II subunit beta
• glucosidase II, beta subunit
• hepatocystin
• PCLD
• PKCSH
• PLD1
• Protein kinase C substrate 60.1 kDa protein heavy chain
• protein kinase C substrate 80K-H
• protein kinase C substrate, 80 Kda protein

Background

PRKCSH encodes the beta-subunit of glucosidase II, an N-linked glycan-processing enzyme in the endoplasmic reticulum (ER). This protein is an acidic phospho-protein known to be a substrate for protein kinase C. Mutations in this gene have been associated with the autosomal dominant polycystic liver disease (PCLD). Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKCSH
• Uniprot:
  • P14314(Human)