PRKCSH Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRKCSH Antibody [NBP2-38492] - Immunofluorescent staining of human cell line MCF7 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: PRKCSH Antibody [NBP2-38492] - Staining in human thyroid gland and skeletal muscle tissues using anti-PRKCSH antibody. Corresponding PRKCSH RNA-seq data are presented for the same tissues.
Immunohistochemistry: PRKCSH Antibody [NBP2-38492] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PRKCSH Antibody [NBP2-38492] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: PRKCSH Antibody [NBP2-38492] - Staining of human thyroid gland shows high expression.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRKCSH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SPAEEDKMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPK
Specificity
Specificity of human PRKCSH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKCSH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRKCSH Protein (NBP2-38492PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRKCSH Antibody

  • AGE-R2,80K-H protein
  • G19P1AGE-binding receptor 2
  • glucosidase 2 subunit beta
  • Glucosidase II subunit beta
  • glucosidase II, beta subunit
  • hepatocystin
  • PCLD
  • PKCSH
  • PLD1
  • Protein kinase C substrate 60.1 kDa protein heavy chain
  • protein kinase C substrate 80K-H
  • protein kinase C substrate, 80 Kda protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61784
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA

Publications for PRKCSH Antibody (NBP2-38492) (0)

There are no publications for PRKCSH Antibody (NBP2-38492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKCSH Antibody (NBP2-38492) (0)

There are no reviews for PRKCSH Antibody (NBP2-38492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRKCSH Antibody (NBP2-38492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PRKCSH Antibody (NBP2-38492)

Discover related pathways, diseases and genes to PRKCSH Antibody (NBP2-38492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKCSH Antibody (NBP2-38492)

Discover more about diseases related to PRKCSH Antibody (NBP2-38492).
 

Pathways for PRKCSH Antibody (NBP2-38492)

View related products by pathway.

PTMs for PRKCSH Antibody (NBP2-38492)

Learn more about PTMs related to PRKCSH Antibody (NBP2-38492).
 

Research Areas for PRKCSH Antibody (NBP2-38492)

Find related products by research area.

Blogs on PRKCSH

There are no specific blogs for PRKCSH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRKCSH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCSH
Uniprot