PRICKLE3 Antibody

Images

 
Immunohistochemistry-Paraffin: PRICKLE3 Antibody [NBP1-82830] - Staining of human gall bladder shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRICKLE3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LIFCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPATGPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRICKLE3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRICKLE3 Protein (NBP1-82830PEP)
Publications
Read Publication using NBP1-82830.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRICKLE3 Antibody

  • LIM domain only 6
  • LIM domain only protein 6
  • LMO-6
  • LMO6Triple LIM domain protein 6
  • prickle homolog 3 (Drosophila)
  • prickle-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87987
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP2-24610
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, ICC/IF, IHC-P
H00000778-A01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for PRICKLE3 Antibody (NBP1-82830)(1)

Reviews for PRICKLE3 Antibody (NBP1-82830) (0)

There are no reviews for PRICKLE3 Antibody (NBP1-82830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRICKLE3 Antibody (NBP1-82830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRICKLE3 Products

Bioinformatics Tool for PRICKLE3 Antibody (NBP1-82830)

Discover related pathways, diseases and genes to PRICKLE3 Antibody (NBP1-82830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRICKLE3

There are no specific blogs for PRICKLE3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRICKLE3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRICKLE3