preproANP Antibody

Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-34105] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-34105] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-34105] - Staining in human heart muscle and skeletal muscle tissues using anti-preproANP antibody. Corresponding preproANP RNA-seq data are presented for the same tissues.

Product Discontinued

preproANP Antibody Summary

• Immunogen: This antibody was developed against recombinant preproANP protein corresponding to amino acids: GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPPA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for preproANP Antibody

• ANF
• ANP
• ATFB6
• atrial natriuretic factor prohormone
• atrial natriuretic peptide prohormone
• ATRST2
• CDD
• CDD-ANF
• CDP
• natriuretic peptides A
• PND

Background

The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. This gene is located adjacent to another member of the natriuretic family of peptides on chromosome 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPPA
• Uniprot:
  • P01160()