PRDM7 Antibody - BSA Free

Western Blot: PRDM7 Antibody [NBP2-93472] - Western blot analysis of extracts of various cell lines, using PRDM7 Rabbit pAb (NBP2-93472) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: PRDM7 Antibody [NBP2-93472] - Analysis of A549 cells using PRDM7 .

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRDM7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRDM7 Antibody - BSA Free (NBP2-93472) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-310 of human PRDM7 (NP_001091643.1). NFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRNCYEYVDGKDK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRDM7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRDM7 Antibody - BSA Free

• probable histone-lysine N-methyltransferase PRDM7
• PFM4
• PR domain containing 7
• ZNF910

Background

The protein encoded by the PRDM7 gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. Alternative splicing results in multiple transcript variants encoding distinct isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDM7