PRDM6 Antibody

Images

 
Western Blot: PRDM6 Antibody [NBP2-83416] - Host: Rabbit. Target Name: PRDM6. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: PRDM6 Antibody [NBP2-83416] - Host: Rabbit. Target: PRDM6. Positive control (+): 293T (2T). Negative control (-): A549 (N03). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRDM6. Peptide sequence: FAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRDM6 Antibody

  • PRDM6 PR domain containing 6
  • putative histone-lysine N-methyltransferase PRDM6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
AF1700
Species: Hu
Applications: ChIP, ICC, IHC, WB
NBP3-15267
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
AF6295
Species: Hu, Mu
Applications: IHC, WB
NBP1-33646
Species: Hu
Applications: ICC/IF, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-52105
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00008209-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PP-A8620A-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-83416
Species: Hu
Applications: WB

Publications for PRDM6 Antibody (NBP2-83416) (0)

There are no publications for PRDM6 Antibody (NBP2-83416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM6 Antibody (NBP2-83416) (0)

There are no reviews for PRDM6 Antibody (NBP2-83416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRDM6 Antibody (NBP2-83416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM6 Products

Array NBP2-83416

Bioinformatics Tool for PRDM6 Antibody (NBP2-83416)

Discover related pathways, diseases and genes to PRDM6 Antibody (NBP2-83416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM6 Antibody (NBP2-83416)

Discover more about diseases related to PRDM6 Antibody (NBP2-83416).
 

Pathways for PRDM6 Antibody (NBP2-83416)

View related products by pathway.

PTMs for PRDM6 Antibody (NBP2-83416)

Learn more about PTMs related to PRDM6 Antibody (NBP2-83416).

Blogs on PRDM6

There are no specific blogs for PRDM6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM6