PRDM15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PRDM15 Antibody [NBP2-58474] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRDM15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRDM15 Antibody - BSA Free (NBP2-58474) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLV
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRDM15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PRDM15 Recombinant Protein Antigen (NBP2-58474PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRDM15 Antibody - BSA Free

• C21orf83
• chromosome 21 open reading frame 83
• PFM15
• PR domain containing 15
• PR domain zinc finger protein 15
• PR domain-containing protein 15
• Zinc finger protein 298
• ZNF298

Background

PRDM15 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDM15