PRAF1 Antibody - Azide and BSA Free

Western Blot: PRAF1 Antibody [H00064425-B01P] - Analysis of POLR1E expression in U-2 OS.

Immunocytochemistry/Immunofluorescence: PRAF1 Antibody [H00064425-B01P] - Analysis of purified antibody to PRAF1 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: PRAF1 Antibody [H00064425-B01P] - Analysis of POLR1E expression in transfected 293T cell line by POLR1E polyclonal antibody. Lane 1: PRAF1 transfected lysate(46.09 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PRAF1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PRAF1 Antibody - Azide and BSA Free (H00064425-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: POLR1E (NP_071935.1, 1 a.a. - 419 a.a.) full-length human protein. MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT
• Specificity: POLR1E - polymerase (RNA) I polypeptide E, 53kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: POLR1E
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRAF1 Antibody - Azide and BSA Free

• DNA-directed RNA polymerase I subunit E
• DNA-directed RNA polymerase I subunit RPA49
• FLJ13390
• FLJ13970
• FLJ43482
• PAF53RNA polymerase I-associated factor 1
• polymerase (RNA) I associated factor 1
• polymerase (RNA) I polypeptide E, 53kDa
• PRAF1
• RNA polymerase I associated factor 53
• RNA polymerase I subunit A49
• RNA polymerase I-associated factor 53
• RP11-405L18.3

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleosidetriphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Appears to beinvolved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I andUBTF/UBF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLR1E
• Entrez:
  • 64425(Human)
• Uniprot:
  • NP_071935.1(Human)