PQBP1 Antibody (1A11)

Western Blot: PQBP1 Antibody (1A11) [H00010084-M01] - Analysis of PQBP1 expression in transfected 293T cell line by PQBP1 monoclonal antibody (M01), clone 1A11.Lane 1: PQBP1 transfected lysate(30.5 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: PQBP1 Antibody (1A11) [H00010084-M01] - Detection limit for recombinant GST tagged PQBP1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 1A11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

PQBP1 Antibody (1A11) Summary

• Immunogen: PQBP1 (NP_005701, 184 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
• Specificity: PQBP1 - polyglutamine binding protein 1 (1A11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PQBP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PQBP1 Antibody (1A11)

• 38 kDa nuclear protein containing a WW domain
• MRX55
• MRXS3
• MRXS8
• Npw38
• NPW38mental retardation, X-linked 55
• nuclear protein containing WW domain 38 kD
• polyglutamine binding protein 1
• Polyglutamine tract-binding protein 1
• polyglutamine-binding protein 1
• PQBP-1
• RENS1
• SHS
• Sutherland-Haan X-linked mental retardation syndrome

Background

PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain (Waragai et al., 1999 [PubMed 10332029]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PQBP1 Antibody (H00010084-M01)(1)

Publication using H00010084-M01

• Volkening K, Keller B, Leysta-Lantz C et al. RNA and protein interactors with TDP-43 in human spinal cord lysates in ALS. J Proteome Res 2018-03-22 [PMID: 29513014]

Bioinformatics

• Gene Symbol: PQBP1
• Entrez:
  • 10084(Human)
• Uniprot:
  • NP_005701(Human)