PPP3CC Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PPP3CC Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP3CC
  
  

  Source: E.coli

  Amino Acid Sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PPP3CC
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25065It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP3CC Recombinant Protein Antigen

• Calcineurin, testis-specific catalytic subunit
• Calmodulin-dependent calcineurin A subunit gamma isoform
• CALNA3
• CALNA3CAM-PRP catalytic subunit
• CNA3
• EC 3.1.3.16
• PP2Bgamma
• PPP3CC
• protein phosphatase 2B, catalytic subunit, gamma isoform
• protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform
• protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma)
• protein phosphatase 3, catalytic subunit, gamma isozyme
• serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform

Background

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP3CC