PPP3CC Recombinant Protein Antigen

Images

 
There are currently no images for PPP3CC Protein (NBP1-86656PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP3CC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP3CC.

Source: E. coli

Amino Acid Sequence: RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP3CC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86656.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP3CC Recombinant Protein Antigen

  • Calcineurin, testis-specific catalytic subunit
  • Calmodulin-dependent calcineurin A subunit gamma isoform
  • CALNA3
  • CALNA3CAM-PRP catalytic subunit
  • CNA3
  • EC 3.1.3.16
  • PP2Bgamma
  • PPP3CC
  • protein phosphatase 2B, catalytic subunit, gamma isoform
  • protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform
  • protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma)
  • protein phosphatase 3, catalytic subunit, gamma isozyme
  • serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform

Background

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80903
Species: Hu
Applications: IHC,  IHC-P
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP1-85299
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1348
Species: Hu, Mu, Rt
Applications: Simple Western, WB
MAB2839
Species: Hu, Mu, Rt
Applications: WB
NBP3-32848
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-46910
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-58895
Species: Hu
Applications: IHC,  IHC-P
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-05546
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-61739
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC,  IHC-P, WB

Publications for PPP3CC Protein (NBP1-86656PEP) (0)

There are no publications for PPP3CC Protein (NBP1-86656PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP3CC Protein (NBP1-86656PEP) (0)

There are no reviews for PPP3CC Protein (NBP1-86656PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP3CC Protein (NBP1-86656PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP3CC Products

Research Areas for PPP3CC Protein (NBP1-86656PEP)

Find related products by research area.

Blogs on PPP3CC

There are no specific blogs for PPP3CC, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP3CC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3CC