Recombinant Human PPP3CC GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human PPP3CC GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-81 of Human PPP3CC
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: PPP3CC
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 34.65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPP3CC GST (N-Term) Protein

• Calcineurin, testis-specific catalytic subunit
• Calmodulin-dependent calcineurin A subunit gamma isoform
• CALNA3
• CALNA3CAM-PRP catalytic subunit
• CNA3
• EC 3.1.3.16
• PP2Bgamma
• PPP3CC
• protein phosphatase 2B, catalytic subunit, gamma isoform
• protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform
• protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma)
• protein phosphatase 3, catalytic subunit, gamma isozyme
• serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform

Background

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PPP3CC