PPP2R5D Antibody

Images

 
Western Blot: PPP2R5D Antibody [NBP1-88960] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: PPP2R5D Antibody [NBP1-88960] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: PPP2R5D Antibody [NBP1-88960] - Staining of human small intestine shows strong cytoplasmic positivity in subsets of glandular cells.
Western Blot: PPP2R5D Antibody [NBP1-88960] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

PPP2R5D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R5D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
PPP2R5D Protein (NBP1-88960PEP)

Alternate Names for PPP2R5D Antibody

  • MGC2134
  • MGC8949
  • PP2A B subunit isoform B56-delta
  • PP2A B subunit isoform B'-delta
  • PP2A B subunit isoform PR61-delta
  • PP2A B subunit isoform R5-delta
  • PP2A, B subunit, B' delta isoform
  • PP2A, B subunit, B56 delta isoform
  • PP2A, B subunit, PR61 delta isoform
  • PP2A, B subunit, R5 delta isoform
  • protein phosphatase 2, regulatory subunit B', delta
  • regulatory subunit B (B56), delta isoform
  • regulatory subunit B', delta isoform
  • Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85196
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8934
Species: Hu
Applications: WB, Simple Western, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-91153
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6526
Species: Hu
Applications: WB
NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP2R5D Antibody (NBP1-88960) (0)

There are no publications for PPP2R5D Antibody (NBP1-88960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5D Antibody (NBP1-88960) (0)

There are no reviews for PPP2R5D Antibody (NBP1-88960). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP2R5D Antibody (NBP1-88960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R5D Antibody Products

Related Products by Gene

Bioinformatics Tool for PPP2R5D Antibody (NBP1-88960)

Discover related pathways, diseases and genes to PPP2R5D Antibody (NBP1-88960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5D Antibody (NBP1-88960)

Discover more about diseases related to PPP2R5D Antibody (NBP1-88960).
 

Pathways for PPP2R5D Antibody (NBP1-88960)

View related products by pathway.

PTMs for PPP2R5D Antibody (NBP1-88960)

Learn more about PTMs related to PPP2R5D Antibody (NBP1-88960).
 

Research Areas for PPP2R5D Antibody (NBP1-88960)

Find related products by research area.

Blogs on PPP2R5D

There are no specific blogs for PPP2R5D, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PPP2R5D

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-88960 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought