PPP2R5D Antibody

Images

 
Western Blot: PPP2R5D Antibody [NBP1-88960] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PPP2R5D Antibody [NBP1-88960] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: PPP2R5D Antibody [NBP1-88960] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R5D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R5D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
PPP2R5D Protein (NBP1-88960PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP2R5D Antibody

  • MGC2134
  • MGC8949
  • PP2A B subunit isoform B56-delta
  • PP2A B subunit isoform B'-delta
  • PP2A B subunit isoform PR61-delta
  • PP2A B subunit isoform R5-delta
  • PP2A, B subunit, B' delta isoform
  • PP2A, B subunit, B56 delta isoform
  • PP2A, B subunit, PR61 delta isoform
  • PP2A, B subunit, R5 delta isoform
  • protein phosphatase 2, regulatory subunit B', delta
  • regulatory subunit B (B56), delta isoform
  • regulatory subunit B', delta isoform
  • Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85196
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004188-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IF, IHC-FrFl
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4429
Species: Mu
Applications: WB
AF6526
Species: Hu
Applications: WB
NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP2R5D Antibody (NBP1-88960) (0)

There are no publications for PPP2R5D Antibody (NBP1-88960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5D Antibody (NBP1-88960) (0)

There are no reviews for PPP2R5D Antibody (NBP1-88960). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R5D Antibody (NBP1-88960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R5D Antibody Products

Related Products by Gene

Bioinformatics Tool for PPP2R5D Antibody (NBP1-88960)

Discover related pathways, diseases and genes to PPP2R5D Antibody (NBP1-88960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5D Antibody (NBP1-88960)

Discover more about diseases related to PPP2R5D Antibody (NBP1-88960).
 

Pathways for PPP2R5D Antibody (NBP1-88960)

View related products by pathway.

PTMs for PPP2R5D Antibody (NBP1-88960)

Learn more about PTMs related to PPP2R5D Antibody (NBP1-88960).
 

Research Areas for PPP2R5D Antibody (NBP1-88960)

Find related products by research area.

Blogs on PPP2R5D

There are no specific blogs for PPP2R5D, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R5D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5D

Customers Who Bought This Also Bought