PPP2R3A Antibody - BSA Free

Immunohistochemistry-Paraffin: PPP2R3A Antibody [NBP1-87234] - Staining of human heart muscle shows distinct cytoplasmic positivity in myocytes.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPP2R3A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPP2R3A Antibody - BSA Free (NBP1-87234) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPVSQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFASG
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PPP2R3A Protein (NBP1-87234PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPP2R3A Antibody - BSA Free

• PP2A subunit B isoform R3 isoform
• PP2A subunit B isoforms B72/B130
• PP2A subunit B isoforms B'-PR72/PR130
• protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform
• protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha
• protein phosphatase 2, regulatory subunit B', alpha
• serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha
• subunit B, R3 isoform

Background

PPP2R3A is a gene that codes for a protein with three isoforms, with lengths of 1150, 529, and 414 amino acids and weights of approximately 130, 61, and 48 kDa respectively. PPP2R3A is thought to modulate substrate selectivity and catalytic activity, as well as facilitate in the localization of catalytic enzymes. Current studies are being done on diseases and disorders related to this gene including retinoblastoma, ataxia, immunodeficiency, malaria, neuronitis, and breast cancer. PPP2R3A has also been shown to have interactions with ATXN7L2, PPP2CA, PPP5C, CDC6, and PPP2R1A in pathways such as the signal transduction PKA signaling, CDK5, mTOR, cell cycle regulation, Wnt signaling, glycogen metabolism, and IL-6 signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R3A