PPP2R2B Recombinant Protein Antigen

Images

 
There are currently no images for PPP2R2B Protein (NBP1-92283PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP2R2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R2B.

Source: E.coli

Amino Acid Sequence: LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP2R2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-92283.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PPP2R2B Recombinant Protein Antigen

  • B55BETA
  • FLJ95686
  • MGC24888
  • PP2A subunit B isoform B55-beta
  • PP2A subunit B isoform beta
  • PP2A subunit B isoform PR55-beta
  • PP2A subunit B isoform R2-beta
  • PP2A, subunit B, B-beta isoform
  • PP2AB55BETA
  • PP2ABBETA
  • PP2APR55B
  • PP2APR55BETA
  • PR2AB55BETA
  • PR2ABBETA
  • PR2APR55BETA
  • PR52B
  • PR55BETA
  • PR55-BETA
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
  • protein phosphatase 2, regulatory subunit B, beta
  • SCA12
  • serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform
  • serine/threonine protein phosphatase 2A, neuronal isoform
  • serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform
  • spinocerebellar ataxia 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP1-52176
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-58916
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-44310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-CS
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-55745
Species: Hu
Applications: ICC/IF
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-92283PEP
Species: Hu
Applications: AC

Publications for PPP2R2B Protein (NBP1-92283PEP) (0)

There are no publications for PPP2R2B Protein (NBP1-92283PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R2B Protein (NBP1-92283PEP) (0)

There are no reviews for PPP2R2B Protein (NBP1-92283PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PPP2R2B Protein (NBP1-92283PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PPP2R2B Protein (NBP1-92283PEP)

Discover related pathways, diseases and genes to PPP2R2B Protein (NBP1-92283PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R2B Protein (NBP1-92283PEP)

Discover more about diseases related to PPP2R2B Protein (NBP1-92283PEP).
 

Pathways for PPP2R2B Protein (NBP1-92283PEP)

View related products by pathway.

PTMs for PPP2R2B Protein (NBP1-92283PEP)

Learn more about PTMs related to PPP2R2B Protein (NBP1-92283PEP).
 

Research Areas for PPP2R2B Protein (NBP1-92283PEP)

Find related products by research area.

Blogs on PPP2R2B

There are no specific blogs for PPP2R2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PPP2R2B Antibody
NBP2-46667

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP2R2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R2B