PPP2R2A Antibody - BSA Free

Western Blot: PPP2R2A Antibody [NBP3-09947] - Western blot analysis of PPP2R2A in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PPP2R2A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPP2R2A Antibody - BSA Free (NBP3-09947) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human 2ABA. Peptide sequence SERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFAN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PPP2R2A Antibody - BSA Free

• B55A
• B55ALPHA
• DKFZp686N05117
• FLJ26613
• FLJ41727
• MGC52248
• PP2A subunit B isoform alpha
• PP2A subunit B isoform B55-alpha
• PP2A subunit B isoform PR55-alpha
• PP2A subunit B isoform R2-alpha
• PR52A
• PR55A
• protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform
• protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform
• protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
• protein phosphatase 2, regulatory subunit B, alpha
• serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform
• serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform

Background

The product of the PPP2R2A gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R2A