PPP2R2A Antibody

Images

 
Western Blot: PPP2R2A Antibody [NBP3-09343] - Western blot analysis of PPP2R2A in Rat Testis lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R2A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat PPP2R2A (NP_446451). Peptide sequence ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI
Specificity
B alpha isoform
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R2A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for PPP2R2A Antibody

  • B55A
  • B55ALPHA
  • DKFZp686N05117
  • FLJ26613
  • FLJ41727
  • MGC52248
  • PP2A subunit B isoform alpha
  • PP2A subunit B isoform B55-alpha
  • PP2A subunit B isoform PR55-alpha
  • PP2A subunit B isoform R2-alpha
  • PR52A
  • PR55A
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
  • protein phosphatase 2, regulatory subunit B, alpha
  • serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform
  • serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87233
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-22990
Species: Hu, Mu
Applications: IP, WB
AF3989
Species: Hu, Mu, Rt
Applications: WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
203-IL/CF
Species: Hu
Applications: BA
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-847
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-19907
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NBP2-15081
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-33735
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for PPP2R2A Antibody (NBP3-09343) (0)

There are no publications for PPP2R2A Antibody (NBP3-09343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R2A Antibody (NBP3-09343) (0)

There are no reviews for PPP2R2A Antibody (NBP3-09343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R2A Antibody (NBP3-09343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R2A Products

Bioinformatics Tool for PPP2R2A Antibody (NBP3-09343)

Discover related pathways, diseases and genes to PPP2R2A Antibody (NBP3-09343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R2A Antibody (NBP3-09343)

Discover more about diseases related to PPP2R2A Antibody (NBP3-09343).
 

Pathways for PPP2R2A Antibody (NBP3-09343)

View related products by pathway.

PTMs for PPP2R2A Antibody (NBP3-09343)

Learn more about PTMs related to PPP2R2A Antibody (NBP3-09343).

Blogs on PPP2R2A

There are no specific blogs for PPP2R2A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R2A