PPP2R1A Antibody - BSA Free

Western Blot: PPP2R1A Antibody [NBP3-38186] - Western blot analysis of various lysates using PPP2R1A Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: PPP2R1A Antibody [NBP3-38186] - Immunofluorescence analysis of U2OS cells using PPP2R1A Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPP2R1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPP2R1A Antibody - BSA Free (NBP3-38186) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PPP2R1A (NP_055040.2).
  
  Sequence:
  MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPP2R1A Antibody - BSA Free

• Medium tumor antigen-associated 61 kDa protein
• MGC786
• PP2A subunit A isoform PR65-alpha
• PP2A subunit A isoform R1-alpha
• PP2AAALPHA
• PP2A-Aalpha
• PR65A
• protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alphaisoform
• protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform
• protein phosphatase 2, regulatory subunit A, alpha
• serine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alphaisoform
• serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alphaisoform

Background

PPP2R1A encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R1A