PPP1R16B Antibody

Images

 
Western Blot: PPP1R16B Antibody [NBP2-86753] - Host: Rabbit. Target Name: PP16B. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP1R16B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PPP1R16B. Peptide sequence: DRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R16B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP1R16B Antibody

  • ANKRD4TIMAPankyrin repeat domain protein 4
  • Ankyrin repeat domain-containing protein 4
  • CAAX box protein TIMAP
  • hTIMAP
  • KIAA0823TGF-beta-inhibited membrane-associated protein
  • protein phosphatase 1 regulatory inhibitor subunit 16B
  • protein phosphatase 1, regulatory (inhibitor) subunit 16B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-38889
Species: Hu
Applications: IP, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00084988-B01P
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37897
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-34685
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-32858
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP1-87751
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-67584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
5396-SF
Species: Hu
Applications: BA
NBP2-86753
Species: Hu
Applications: WB

Publications for PPP1R16B Antibody (NBP2-86753) (0)

There are no publications for PPP1R16B Antibody (NBP2-86753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R16B Antibody (NBP2-86753) (0)

There are no reviews for PPP1R16B Antibody (NBP2-86753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP1R16B Antibody (NBP2-86753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP1R16B Products

Bioinformatics Tool for PPP1R16B Antibody (NBP2-86753)

Discover related pathways, diseases and genes to PPP1R16B Antibody (NBP2-86753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R16B Antibody (NBP2-86753)

Discover more about diseases related to PPP1R16B Antibody (NBP2-86753).
 

Pathways for PPP1R16B Antibody (NBP2-86753)

View related products by pathway.

PTMs for PPP1R16B Antibody (NBP2-86753)

Learn more about PTMs related to PPP1R16B Antibody (NBP2-86753).

Blogs on PPP1R16B

There are no specific blogs for PPP1R16B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP1R16B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R16B