PPOX Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PPOX Antibody [NBP1-80885] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunohistochemistry: PPOX Antibody [NBP1-80885] - Staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPOX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAAPLARALSAITAVSVAVVNLQYQGAH
Specificity
Specificity of human PPOX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPOX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPOX Antibody

  • EC 1.3.3.4
  • MGC8485
  • PPOVP
  • protoporphyrinogen oxidase
  • V290M
  • variegate porphyria

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76346
Species: Mu, Rt
Applications: Flow, PEP-ELISA, IF
NBP2-76346
Species: Mu, Rt
Applications: Flow, PEP-ELISA, IF
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF5805
Species: Hu
Applications: WB
7954-GM/CF
Species: Hu
NBP1-54863
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM, KD
NBP2-67339
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87329
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu
NBP1-57356
Species: Hu
Applications: WB

Publications for PPOX Antibody (NBP1-80885) (0)

There are no publications for PPOX Antibody (NBP1-80885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPOX Antibody (NBP1-80885) (0)

There are no reviews for PPOX Antibody (NBP1-80885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PPOX Antibody (NBP1-80885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PPOX Products

Bioinformatics Tool for PPOX Antibody (NBP1-80885)

Discover related pathways, diseases and genes to PPOX Antibody (NBP1-80885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPOX Antibody (NBP1-80885)

Discover more about diseases related to PPOX Antibody (NBP1-80885).
 

Pathways for PPOX Antibody (NBP1-80885)

View related products by pathway.

PTMs for PPOX Antibody (NBP1-80885)

Learn more about PTMs related to PPOX Antibody (NBP1-80885).
 

Research Areas for PPOX Antibody (NBP1-80885)

Find related products by research area.

Blogs on PPOX

There are no specific blogs for PPOX, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPOX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPOX
Entrez
Uniprot
COVID-19 update