New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

PPM1K Antibody

Images

 
Western Blot: PPM1K Antibody [NBP1-85036] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: PPM1K Antibody [NBP1-85036] - Staining of human rectum shows cytoplasmic positivity in glandular cells.
Western Blot: PPM1K Antibody [NBP1-85036] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPM1K Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATLLTSGTTATVALLRDGIELVVASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIA
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPM1K
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPM1K Protein (NBP1-85036PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPM1K Antibody

  • DKFZp667B084
  • DKFZp761G058
  • mitochondrial
  • PP2C domain-containing protein phosphatase 1K
  • PP2Ckappa
  • PP2C-like mitochondrial protein
  • PP2CM
  • PP2C-type mitochondrial phosphoprotein phosphatase
  • protein phosphatase 2C kappa
  • protein phosphatase, Mg2+/Mn2+ dependent, 1K
  • PTMPEC 3.1.3.16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NLS1049
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC, IHC-P
M1300CB
Species: Mu
Applications: ELISA
H00054738-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-76905
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB9080
Species: Hu
Applications: WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
7570-GH
Species: Hu
Applications: EnzAct
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
M5000
Species: Mu
Applications: ELISA
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-10064
Species: Hu
Applications: WB

Publications for PPM1K Antibody (NBP1-85036) (0)

There are no publications for PPM1K Antibody (NBP1-85036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPM1K Antibody (NBP1-85036) (0)

There are no reviews for PPM1K Antibody (NBP1-85036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPM1K Antibody (NBP1-85036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPM1K Products

Bioinformatics Tool for PPM1K Antibody (NBP1-85036)

Discover related pathways, diseases and genes to PPM1K Antibody (NBP1-85036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPM1K Antibody (NBP1-85036)

Discover more about diseases related to PPM1K Antibody (NBP1-85036).
 

Pathways for PPM1K Antibody (NBP1-85036)

View related products by pathway.

Research Areas for PPM1K Antibody (NBP1-85036)

Find related products by research area.

Blogs on PPM1K

There are no specific blogs for PPM1K, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPM1K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1K