PPM1E Recombinant Protein Antigen

Images

 
There are currently no images for PPM1E Protein (NBP1-86649PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPM1E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1E.

Source: E. coli

Amino Acid Sequence: EVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSKLHEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86649.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPM1E Recombinant Protein Antigen

  • ca(2+)/calmodulin-dependent protein kinase phosphatase N
  • CAMKN
  • CaMKP-N
  • caMKP-nucleus
  • DKFZp781F1422
  • KIAA1072
  • nuclear calmodulin-dependent protein kinase phosphatase
  • partner of PIX 1
  • partner of PIXA
  • partner of PIX-alpha
  • POPX1
  • PP2CH
  • protein phosphatase 1E (PP2C domain containing)
  • protein phosphatase 1E
  • protein phosphatase, Mg2+/Mn2+ dependent, 1E

Background

The protein encoded by the PPM1E gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase was identified as an interacting protein of Rho guanine nucleotide exchange factors (PIX). PIX proteins are regulators of p21/Cdc42/Rac1-activated kinase 1 (PAK1), a protein kinase mediating biological effects downstream of Rho GTPases. This phosphatase has been shown to block the effects of PAK, and thus inhibit actin stress fiber breakdown and morphological changes driven by cell division cycle 42 (CDC42). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88207
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF7899
Species: Hu
Applications: IHC, WB
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-45952
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-20715
Species: Hu, Rt
Applications: WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-85889
Species: Hu
Applications: WB
NBP1-32751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00008539-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-15581
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86649PEP
Species: Hu
Applications: AC

Publications for PPM1E Protein (NBP1-86649PEP) (0)

There are no publications for PPM1E Protein (NBP1-86649PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPM1E Protein (NBP1-86649PEP) (0)

There are no reviews for PPM1E Protein (NBP1-86649PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPM1E Protein (NBP1-86649PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPM1E Products

Array NBP1-86649PEP

Research Areas for PPM1E Protein (NBP1-86649PEP)

Find related products by research area.

Blogs on PPM1E

There are no specific blogs for PPM1E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPM1E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1E