PPIL2 Antibody

Images

 
Western Blot: PPIL2 Antibody [NBP1-54366] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Immunohistochemistry: PPIL2 Antibody [NBP1-54366] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: N/A Other Working ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPIL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PPIL2(peptidylprolyl isomerase (cyclophilin)-like 2) The peptide sequence was selected from the C terminal of PPIL2. Peptide sequence GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against PPIL2 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPIL2 Antibody

  • CYC4
  • cyclophilin, 60kDa
  • cyclophilin-60
  • Cyclophilin-like protein Cyp-60
  • CYP60
  • Cyp-60
  • EC 5.2.1.8
  • FLJ39930
  • hCyP-60
  • MGC33174
  • MGC787
  • peptidylprolyl cis-trans isomerase
  • peptidyl-prolyl cis-trans isomerase-like 2
  • peptidylprolyl isomerase (cyclophilin)-like 2
  • PPIase
  • Rotamase PPIL2

Background

PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteinase inhibitor eglin c and is localized in the nucleus. This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteinase inhibitor eglin c and is localized in the nucleus. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB3777
Species: Hu, Mu, Rt
Applications: WB
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-84675
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-83890
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84676
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP1-54366
Species: Hu
Applications: WB, IHC

Publications for PPIL2 Antibody (NBP1-54366) (0)

There are no publications for PPIL2 Antibody (NBP1-54366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIL2 Antibody (NBP1-54366) (0)

There are no reviews for PPIL2 Antibody (NBP1-54366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPIL2 Antibody (NBP1-54366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PPIL2 Antibody (NBP1-54366)

Discover related pathways, diseases and genes to PPIL2 Antibody (NBP1-54366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPIL2 Antibody (NBP1-54366)

Discover more about diseases related to PPIL2 Antibody (NBP1-54366).
 

Pathways for PPIL2 Antibody (NBP1-54366)

View related products by pathway.

PTMs for PPIL2 Antibody (NBP1-54366)

Learn more about PTMs related to PPIL2 Antibody (NBP1-54366).

Blogs on PPIL2

There are no specific blogs for PPIL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPIL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIL2
Uniprot