PPIL1 Antibody

Images

 
Western Blot: PPIL1 Antibody [NBP2-57062] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: PPIL1 Antibody [NBP2-57062] - Staining of human cell line SK-MEL-30 shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPIL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Specificity
Specificity of human PPIL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPIL1 Recombinant Protein Antigen (NBP2-57062PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PPIL1 Antibody

  • CYPL1cyclophilin-related gene 1
  • EC 5.2.1.8
  • hCyPX
  • MGC678
  • peptidyl-prolyl cis-trans isomerase
  • peptidyl-prolyl cis-trans isomerase-like 1
  • peptidylprolyl isomerase (cyclophilin)-like 1
  • PPIase
  • Rotamase PPIL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB3777
Species: Hu, Mu, Rt
Applications: WB
MAB7670
Species: Hu
Applications: WB, ICC
NBP1-84675
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84676
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83890
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49242
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3580
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57062
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for PPIL1 Antibody (NBP2-57062) (0)

There are no publications for PPIL1 Antibody (NBP2-57062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIL1 Antibody (NBP2-57062) (0)

There are no reviews for PPIL1 Antibody (NBP2-57062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPIL1 Antibody (NBP2-57062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PPIL1 Antibody (NBP2-57062)

Discover related pathways, diseases and genes to PPIL1 Antibody (NBP2-57062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPIL1 Antibody (NBP2-57062)

Discover more about diseases related to PPIL1 Antibody (NBP2-57062).
 

Pathways for PPIL1 Antibody (NBP2-57062)

View related products by pathway.

Blogs on PPIL1

There are no specific blogs for PPIL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPIL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIL1