PPFIA3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat PPFIA3. Peptide sequence: ETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPFIA3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PPFIA3 Antibody - BSA Free
Background
PPFIA3, also known as Liprin-alpha-3, has a 1,194 amino acid long isoform that is 133kDa and a slightly shorter 1,185 amino acid isoform that is approximately 132kDa. PPFIA3 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. PPFIA3 is localized to the cytoplasm and cell surface, and is highly expressed in the brain. As a member of the Liprin family, research shows that PPFIA3 may play a role in the disassembly of focal adhesions. Current research surrounding PPFIA3 shows that it may be implicated in various diseases and disorders including cerebritis, cerebral malformations, cocaine abuse, neuronitis and epilepsy. PPFIA3 has also been shown to interact with GIT1, PTPRS, PIK3R1, ERC2, and PPFIBP2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: WB
Publications for PPFIA3 Antibody (NBP2-85513) (0)
There are no publications for PPFIA3 Antibody (NBP2-85513).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PPFIA3 Antibody (NBP2-85513) (0)
There are no reviews for PPFIA3 Antibody (NBP2-85513).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PPFIA3 Antibody (NBP2-85513) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PPFIA3 Products
Research Areas for PPFIA3 Antibody (NBP2-85513)
Find related products by research area.
|
Blogs on PPFIA3