Recombinant Human PPAPDC1B/DPPL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPAPDC1B/DPPL1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 175 of Human PPAPDC1B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWLYRNPYVEAEYFPTKPMFVIAFLSPLSLIFLAKFLKKADTRDSRQACLAASLALALNGVFTNTIKLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRFCAFLSPLLFAAVIALSRTCDYKHHWQGPFKW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PPAPDC1B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPAPDC1B/DPPL1 Protein

  • diacylglycerol pyrophosphate like 1
  • DPPL1
  • EC 3.1.3.4
  • HTPAPphosphatidate phosphatase PPAPDC1B
  • phosphatidic acid phosphatase type 2 domain containing 1B
  • Phosphatidic acid phosphatase type 2 domain-containing protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2987
Species: Hu
Applications: WB, ICC
21400002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56696
Species: Hu
Applications: WB, Flow
NBP1-83078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04991
Species: Hu
Applications: ICC/IF (-), WB
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-35013
Species: Hu
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF

Publications for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01) (0)

There are no publications for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01) (0)

There are no reviews for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPAPDC1B/DPPL1 Products

Bioinformatics Tool for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01)

Discover related pathways, diseases and genes to PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01)

Discover more about diseases related to PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01).

Blogs on PPAPDC1B/DPPL1

There are no specific blogs for PPAPDC1B/DPPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

4EBP1 Antibody
NB200-157
FGF-4 [Unconjugated]
235-F4-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPAPDC1B/DPPL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAPDC1B