Home » PPAPDC1B/DPPL1 » PPAPDC1B/DPPL1 Proteins » Recombinant Human PPAPDC1B/DPPL1 Protein

Recombinant Human PPAPDC1B/DPPL1 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human PPAPDC1B/DPPL1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 175 of Human PPAPDC1B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWLYRNPYVEAEYFPTKPMFVIAFLSPLSLIFLAKFLKKADTRDSRQACLAASLALALNGVFTNTIKLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRFCAFLSPLLFAAVIALSRTCDYKHHWQGPFKW
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PPAPDC1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
46.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPAPDC1B/DPPL1 Protein

  • diacylglycerol pyrophosphate like 1
  • DPPL1
  • EC 3.1.3.4
  • HTPAPphosphatidate phosphatase PPAPDC1B
  • phosphatidic acid phosphatase type 2 domain containing 1B
  • Phosphatidic acid phosphatase type 2 domain-containing protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAM126A Antibody
NBP2-13980
Western Blot: FAM126A Antibody [NBP2-13980] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403173)
Immunocytochemistry/Immunofluorescence: FAM126A Antibody [NBP2-13980] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: FAM126A Antibody [NBP2-13980] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p70 S6 Kinase
beta/S6K2 Antibody [U ...
AF2987
Western blot shows lysates of MCF‑7 human breast cancer cell line. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human p70 S6 Kinase  beta  Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2987) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for p70 S6 Kinase  beta at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p70 S6 Kinase  beta was detected in immersion fixed MCF‑7 human breast cancer cell line using Goat Anti-Human p70 S6 Kinase  beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2987) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC
DDHD2 Antibody
21400002
Western Blot: DDHD2 Antibody [21400002] - Samples: Lane 1, Marker [kDa]: 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2, RT-4 Lane 3, U-251MG sp Lane 4, Human Plasma Lane 5, Liver Lane 6, Tonsil, Target weight [kDa]: 81, 44 (splice variants) Validation score: 2 Validation description: Supportive - Band of predicted size in kDa (+/-20%) with additional bands present.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
LSM1 Antibody
(OTI5C6)
NBP2-00918
Western Blot: LSM1 Antibody (5C6) [NBP2-00918] Analysis of extracts (35ug) from 9 different cell lines by using anti-LSM1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: LSM1 Antibody (5C6) [NBP2-00918] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY LSM1.
Immunohistochemistry-Paraffin: LSM1 Antibody (5C6) [NBP2-00918] - Staining of paraffin-embedded Human Kidney tissue using anti-LSM1 mouse monoclonal antibody.
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
4EBP1 Antibody
NB200-157
Western Blot: 4EBP1 Antibody [NB200-157] - Whole cell lysate (100 ug) from RINm5F insulinoma exposed to high or low concentration of leucine. Antibody used at 0.25 ug/ml.
Immunohistochemistry: 4EBP1 Antibody [NB200-157] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-4EBP1 used at a dilution of 1:20,000 ( 0.05ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
(45 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Reg3A Antibody
NBP2-24763
Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3a Antibody [NBP2-24763] - Formalin-fixed, paraffin-embedded human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(1 Publication)
Species: Hu, Pm
Applications: WB, IHC-P
PDAP1 Knockout
293T Cell Lysate
NBP2-65749
PDAP1 Knockout 293T Cell Lysate
Species: Hu
SODD/BAG4 Antibody
NB100-56696
Western Blot: SODD/BAG4 Antibody [NB100-56696] - Analysis of 30 ug of total cell lysate from HeLa cells with anti-SODD at 2 ug/ml.
(4 Publications)
Species: Hu
Applications: WB, Flow
DUSP22 Antibody
NBP1-83078
Western Blot: DUSP22 Antibody [NBP1-83078] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: DUSP22 Antibody [NBP1-83078] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NSD3 Antibody
NBP1-04991
Western Blot: NSD3 Antibody [NBP1-04991] - Detection of NSD3 (isoform 3) in HeLa nuclear extracts using NBP1-04991.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF (-), WB
Recombinant Human
PRH2 Protein
H00005555-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
PRH1 RNAi
H00005554-R02
Species: Hu
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Western Blot: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pancreatic Amylase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pancreatic Amylase.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of EPB42 expression in transfected 293T cell line by EPB42 monoclonal antibody (M01), clone 2G12.Lane 1: EPB42 transfected lysate(69.5 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of monoclonal antibody to EPB42 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: EPB42 Antibody (2G12) [H00002038-M01] - Detection limit for recombinant GST tagged EPB42 is 1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF
FGF R1 Antibody
(M19B2)
NB600-1287
Western Blot: FGF R1 Antibody (M19B2) [NB600-1287] - Western blot analysis of MCF7 (A), HepG2 (B), NIH3T3 (C), and PC-12 (D) cell lysate using FGF R1 antibody at 2 ug/ml.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis using the Alexa Fluor (R) 488 conjugate of NB600-1287. Staining of FGF R1 in HEK293 and HEK293 FGFR transfected cells using anti-FGF R1 antibody. Red - positive cells, Green - negative cells, Blue - negative cells + antibody, Pink - positive cells + antibody. Image from verified customer review.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Intracellular flow cytometric staining of 1 x 10^6 HEK-293 cells using FGF R1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
ASAP1 [p Tyr782]
Antibody
NBP1-77933
Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.
Immunohistochemistry: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Used at 20 g/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate intracellular positive staining in epidermal keratinocytes in human skin at 40X. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain. Personal Communication, Tina Roush, LifeSpanBiosciences, Seattle, WA.
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MYBBP1A Antibody
NB100-61050
Immunohistochemistry: MYBBP1A Antibody [NB100-61050] - Sample: FFPE section of human colon carcinoma. Antibody: Affinity purified rabbit anti- MYBBP1a used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MYBBP1A Antibody [NB100-61050] - Detection of Human MYBBP1a by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MYBBP1a antibody NB100-61050 used for IP at 3 mcg/mg lysate. MYBBP1a was also immunoprecipitated by rabbit anti-MYBBP1a antibody NB100-61051, which recognizes a downstream epitope.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
FGF-4
[Unconjugated]
235-F4
1 μg/lane of Recombinant Human FGF-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 16 kDa.
Recombinant Human FGF-4 (Catalog # 235‑F4) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 0.25‑1.25 ng/mL.
(1 Review)
(34 Publications)
Species: Hu
FGF-3 Antibody
(MSD1)
NB200-603
FGF-3 Antibody (MSD1)
(1 Review)
(1 Publication)
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Recombinant Human
PPAPDC1B/DPPL1 Protei ...
H00084513-P01
Recombinant Human PPAPDC1B/DPPL1 Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01) (0)

There are no publications for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01) (0)

There are no reviews for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPAPDC1B/DPPL1 Products

Bioinformatics Tool for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01)

Discover related pathways, diseases and genes to PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01)

Discover more about diseases related to PPAPDC1B/DPPL1 Recombinant Protein (H00084513-P01).

Blogs on PPAPDC1B/DPPL1

There are no specific blogs for PPAPDC1B/DPPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PPAPDC1B/DPPL1 Recombinant Protein Antigen
NBP2-55527PEP
Western Blot: 4EBP1 Antibody [NB200-157] - Whole cell lysate (100 ug) from RINm5F insulinoma exposed to high or low concentration of leucine. Antibody used at 0.25 ug/ml.
4EBP1 Antibody
NB200-157
Immunocytochemistry/Immunofluorescence: PPAPDC1B/DPPL1 Antibody [NBP2-55527] - Staining of human cell line U-2 OS shows localization to vesicles.
PPAPDC1B/DPPL1 Antibody
NBP2-55527
1 μg/lane of Recombinant Human FGF-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 16 kDa.
FGF-4 [Unconjugated]
235-F4-025

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPAPDC1B/DPPL1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol PPAPDC1B