Recombinant Human PPAP2A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PPAP2A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-284 of Human PPAP2A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PPAP2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
56.98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPAP2A Protein

  • EC 3.1.3.4
  • lipid phosphate phosphohydrolase 1
  • lipid phosphate phosphohydrolase 1a
  • LLP1a
  • LPP1PAP2a2
  • PAP2
  • PAP2a
  • PAP2-alpha
  • PAP-2aPAP2alpha2
  • PAPalpha1
  • Phosphatidate phosphohydrolase type 2a
  • Phosphatidic acid phosphatase 2a
  • phosphatidic acid phosphatase type 2A
  • phosphatidic acid phosphohydrolase type 2a
  • type 2 phosphatidic acid phosphohydrolase
  • type-2 phosphatidic acid phosphatase alpha

Background

PPAP2A( AAH39847, 1 a.a. - 285 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-65749
Species: Hu
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-65899
Species: Hu
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005555-P01
Species: Hu
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-31607
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57350
Species: Hu
Applications: WB, ICC/IF
NBP1-89549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPAP2A Recombinant Protein (H00008611-P01) (0)

There are no publications for PPAP2A Recombinant Protein (H00008611-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAP2A Recombinant Protein (H00008611-P01) (0)

There are no reviews for PPAP2A Recombinant Protein (H00008611-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAP2A Recombinant Protein (H00008611-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPAP2A Products

Bioinformatics Tool for PPAP2A Recombinant Protein (H00008611-P01)

Discover related pathways, diseases and genes to PPAP2A Recombinant Protein (H00008611-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAP2A Recombinant Protein (H00008611-P01)

Discover more about diseases related to PPAP2A Recombinant Protein (H00008611-P01).
 

Pathways for PPAP2A Recombinant Protein (H00008611-P01)

View related products by pathway.

PTMs for PPAP2A Recombinant Protein (H00008611-P01)

Learn more about PTMs related to PPAP2A Recombinant Protein (H00008611-P01).
 

Research Areas for PPAP2A Recombinant Protein (H00008611-P01)

Find related products by research area.

Blogs on PPAP2A

There are no specific blogs for PPAP2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Reg3A Antibody
NBP2-24763

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPAP2A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAP2A