PPAP2A Antibody - BSA Free

Western Blot: PPAP2A Antibody [NBP1-59011] - HepG2 cell lysate, Antibody Titration: 5.0ug/ml

Immunohistochemistry-Paraffin: PPAP2A Antibody [NBP1-59011] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Discontinued

PPAP2A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PPAP2A(phosphatidic acid phosphatase type 2A) The peptide sequence was selected from the N terminal of PPAP2A. Peptide sequence QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLPP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for PPAP2A Antibody - BSA Free

• EC 3.1.3.4
• lipid phosphate phosphohydrolase 1
• lipid phosphate phosphohydrolase 1a
• LLP1a
• LPP1PAP2a2
• PAP2
• PAP2a
• PAP2-alpha
• PAP-2aPAP2alpha2
• PAPalpha1
• Phosphatidate phosphohydrolase type 2a
• Phosphatidic acid phosphatase 2a
• phosphatidic acid phosphatase type 2A
• phosphatidic acid phosphohydrolase type 2a
• type 2 phosphatidic acid phosphohydrolase
• type-2 phosphatidic acid phosphatase alpha

Background

PPAP2A is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space.The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space. The expression of this gene is found to be regulated by androgen in a prostatic adenocarcinoma cell line. At least two alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPAP2A Antibody (NBP1-59011)(1)

Publication using NBP1-59011

• Pengyu Geng, Jinhui Zhao, Qi Li, Xiaolin Wang, Wangshu Qin, Ting Wang, Xianzhe Shi, Xinyu Liu, Jia Chen, Hongdeng Qiu, Guowang Xu, David A. Gewirtz, David Mu Z-Ligustilide Combined with Cisplatin Reduces PLPP1-Mediated Phospholipid Synthesis to Impair Cisplatin Resistance in Lung Cancer International Journal of Molecular Sciences 2023-12-01 [PMID: 38069368]

Bioinformatics

• Gene Symbol: PLPP1
• Uniprot:
  • O14494-2(Human)