Recombinant Human PP2C epsilon/PPM1L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PP2C epsilon/PPM1L Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 360 of Human PPM1L full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PPM1L
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PP2C epsilon/PPM1L Protein

  • EC 3.1.3
  • EC 3.1.3.16
  • MGC132545
  • MGC132547
  • PP2C epsilon
  • PP2CE
  • PP2CEProtein phosphatase 2C isoform epsilon
  • PP2C-epsilon
  • PPM1L
  • PPM1-LIKE
  • protein phosphatase 1 (formerly 2C)-like
  • protein phosphatase 1L
  • Protein phosphatase 1-like
  • Protein phosphatase 2C epsilon isoform
  • protein phosphatase, Mg2+/Mn2+ dependent, 1L

Background

PPM1L, or PP2CE, belongs to the PP2C group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. PP2Cs regulate stress-activated protein kinase (SAPK; see MIM 601158) signaling cascades that respond to extracellular stimuli (Jin et al., 2004 [PubMed 15560375]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00064746-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF2346
Species: Mu
Applications: WB, IP
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NBP1-81590
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000817-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
NB100-2803
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-57716
Species: Hu
Applications: WB
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4885
Species: Mu
Applications: WB, IP
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-1538
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90003
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01) (0)

There are no publications for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01) (0)

There are no reviews for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PP2C epsilon/PPM1L Products

Bioinformatics Tool for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01)

Discover related pathways, diseases and genes to PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01)

Discover more about diseases related to PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01).
 

Pathways for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01)

View related products by pathway.

Research Areas for PP2C epsilon/PPM1L Recombinant Protein (H00151742-P01)

Find related products by research area.

Blogs on PP2C epsilon/PPM1L

There are no specific blogs for PP2C epsilon/PPM1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PP2C epsilon/PPM1L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1L
Entrez