We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PP2C epsilon/PPM1L Recombinant Protein Antigen

Images

 
There are currently no images for PP2C epsilon/PPM1L Protein (NBP1-87247PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PP2C epsilon/PPM1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1L.

Source: E. coli

Amino Acid Sequence: DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87247.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PP2C epsilon/PPM1L Recombinant Protein Antigen

  • EC 3.1.3
  • EC 3.1.3.16
  • MGC132545
  • MGC132547
  • PP2C epsilon
  • PP2CE
  • PP2CEProtein phosphatase 2C isoform epsilon
  • PP2C-epsilon
  • PPM1L
  • PPM1-LIKE
  • protein phosphatase 1 (formerly 2C)-like
  • protein phosphatase 1L
  • Protein phosphatase 1-like
  • Protein phosphatase 2C epsilon isoform
  • protein phosphatase, Mg2+/Mn2+ dependent, 1L

Background

PPM1L, or PP2CE, belongs to the PP2C group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. PP2Cs regulate stress-activated protein kinase (SAPK; see MIM 601158) signaling cascades that respond to extracellular stimuli (Jin et al., 2004 [PubMed 15560375]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00064746-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-20476
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NBP3-46452
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00000817-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NB100-2803
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-16168
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-88057
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31237
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
5444-SL
Species: Mu
Applications: BA
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-1538
Species: Ha, Hu, Rt
Applications: IHC,  IHC-P, IP, PEP-ELISA, WB
NBP1-90004
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for PP2C epsilon/PPM1L Protein (NBP1-87247PEP) (0)

There are no publications for PP2C epsilon/PPM1L Protein (NBP1-87247PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C epsilon/PPM1L Protein (NBP1-87247PEP) (0)

There are no reviews for PP2C epsilon/PPM1L Protein (NBP1-87247PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PP2C epsilon/PPM1L Protein (NBP1-87247PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PP2C epsilon/PPM1L Products

Research Areas for PP2C epsilon/PPM1L Protein (NBP1-87247PEP)

Find related products by research area.

Blogs on PP2C epsilon/PPM1L

There are no specific blogs for PP2C epsilon/PPM1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PP2C epsilon/PPM1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1L