PP2C beta/PPM1B Antibody

Images

 
Western Blot: PPM1B Antibody [NBP1-87250] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: PPM1B Antibody [NBP1-87250] - Staining of human cell line A-431 shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: PPM1B Antibody [NBP1-87250] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PP2C beta/PPM1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPM1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PP2C beta/PPM1B Protein (NBP1-87250PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PP2C beta/PPM1B Antibody

  • EC 3.1.3.16
  • MGC21657
  • PP2C beta
  • Pp2c2
  • PP2CB
  • PP2C-beta
  • PP2C-beta-X
  • PP2CBmagnesium-dependent, beta isoform
  • PPM1B
  • protein phosphatase 1B
  • Protein phosphatase 2C isoform beta
  • protein phosphatase 2C-like protein
  • protein phosphatase, Mg2+/Mn2+ dependent, 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32751
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31868
Species: Hu
Applications: IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-01859
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA

Publications for PP2C beta/PPM1B Antibody (NBP1-87250) (0)

There are no publications for PP2C beta/PPM1B Antibody (NBP1-87250).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C beta/PPM1B Antibody (NBP1-87250) (0)

There are no reviews for PP2C beta/PPM1B Antibody (NBP1-87250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PP2C beta/PPM1B Antibody (NBP1-87250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PP2C beta/PPM1B Products

Bioinformatics Tool for PP2C beta/PPM1B Antibody (NBP1-87250)

Discover related pathways, diseases and genes to PP2C beta/PPM1B Antibody (NBP1-87250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C beta/PPM1B Antibody (NBP1-87250)

Discover more about diseases related to PP2C beta/PPM1B Antibody (NBP1-87250).
 

Pathways for PP2C beta/PPM1B Antibody (NBP1-87250)

View related products by pathway.

PTMs for PP2C beta/PPM1B Antibody (NBP1-87250)

Learn more about PTMs related to PP2C beta/PPM1B Antibody (NBP1-87250).
 

Research Areas for PP2C beta/PPM1B Antibody (NBP1-87250)

Find related products by research area.

Blogs on PP2C beta/PPM1B

There are no specific blogs for PP2C beta/PPM1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PP2C beta/PPM1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1B
Entrez