POU5F2 Antibody


Western Blot: POU5F2 Antibody [NBP2-86751] - WB Suggested Anti-POU5F2 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

POU5F2 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of human POU5F2. Peptide sequence: KDVVRVWFYNRSKMGSRPTNDASPREIVGTAGPPCPGAPVCFHLGLGLPV The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Protein A purified

Alternate Names for POU5F2 Antibody

  • DKFZp686P02123
  • FLJ25680
  • POU domain class 5, transcription factor 2
  • Sperm 1 POU domain transcription factor
  • SPRM1
  • SPRM-1POU domain, class 5, transcription factor 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, PA, WB
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Pm, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for POU5F2 Antibody (NBP2-86751) (0)

There are no publications for POU5F2 Antibody (NBP2-86751).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU5F2 Antibody (NBP2-86751) (0)

There are no reviews for POU5F2 Antibody (NBP2-86751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU5F2 Antibody (NBP2-86751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional POU5F2 Products

Bioinformatics Tool for POU5F2 Antibody (NBP2-86751)

Discover related pathways, diseases and genes to POU5F2 Antibody (NBP2-86751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on POU5F2

There are no specific blogs for POU5F2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our POU5F2 Antibody and receive a gift card or discount.


Gene Symbol POU5F2