POU5F2 Antibody - BSA Free

Western Blot: POU5F2 Antibody [NBP2-86750] - WB Suggested Anti-POU5F2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: THP-1 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

POU5F2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit POU5F2 Antibody - BSA Free (NBP2-86750) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human POU5F2. Peptide sequence: EFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU5F2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for POU5F2 Antibody - BSA Free

• DKFZp686P02123
• FLJ25680
• POU domain class 5, transcription factor 2
• Sperm 1 POU domain transcription factor
• SPRM1
• SPRM-1POU domain, class 5, transcription factor 2

Background

Transcription factor that binds preferentially to the octamer motif (5'-ATGTTAAT-3'). May exert a regulatoryfunction in meiotic events that are required for terminal differentiation of male germ cell

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU5F2